PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe7G043700.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family HD-ZIP
Protein Properties Length: 820aa    MW: 88406.2 Da    PI: 5.6912
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe7G043700.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.43.8e-21117172156
                        TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        +++ +++t++q++eLe+lF+++++p++++r eL+++l L+ rqVk+WFqNrR+++k
  Aqcoe7G043700.3.p 117 KKRYHRHTPQQIQELEALFKECPHPDEKQRMELSRRLCLESRQVKFWFQNRRTQMK 172
                        688999***********************************************999 PP

2START205.22.5e-643245471206
                        HHHHHHHHHHHHHHHHC-TT-EEEE...EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEE CS
              START   1 elaeeaaqelvkkalaeepgWvkss...esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kae 80 
                        ela++a++elvk+a+ +ep+W+  +   e +n++e+++ f++  +     + +ea r++g+v+ +++ lve+l+d + +W e+++    + +
  Aqcoe7G043700.3.p 324 ELALAAMDELVKMAQTDEPLWMPGVggkETLNQEEYMRMFPPCIGmkpngFVTEATRETGMVIINAEALVETLMDAN-RWAEMFPcmiaRTS 414
                        5899**************************************999999*9***************************.************** PP

                        EEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEE CS
              START  81 tlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvt 165
                        t +vi sg      g lqlm aelq+lsplvp R++ f+R+++q+ +g+w++vdvSvd +++ p+s+ +v +++lpSg+++++++ng+skv+
  Aqcoe7G043700.3.p 415 TADVIASGvggtrnGSLQLMHAELQVLSPLVPiRESNFLRFCKQHAEGVWAVVDVSVDTNRETPNSPAFVTCRRLPSGCVVQDMPNGYSKVI 506
                        ******************************************************************************************** PP

                        EEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
              START 166 wvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                        wveh++++++++h l+r+l++ g+ +ga++wvatl+rqce+
  Aqcoe7G043700.3.p 507 WVEHAEYDASIIHRLYRPLISAGMGFGAQRWVATLERQCEC 547
                        ***************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.33E-20101174IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.9E-22111182IPR009057Homeodomain-like
PROSITE profilePS5007117.297114174IPR001356Homeobox domain
SMARTSM003899.7E-17115178IPR001356Homeobox domain
CDDcd000863.83E-18116174No hitNo description
PfamPF000461.2E-18117172IPR001356Homeobox domain
PROSITE patternPS000270149172IPR017970Homeobox, conserved site
PROSITE profilePS5084843.961315550IPR002913START domain
SuperFamilySSF559612.7E-34317547No hitNo description
CDDcd088752.76E-123319546No hitNo description
PfamPF018522.4E-56324547IPR002913START domain
SMARTSM002341.8E-47324547IPR002913START domain
Gene3DG3DSA:3.30.530.201.4E-5380523IPR023393START-like domain
SuperFamilySSF559613.18E-25574744No hitNo description
SuperFamilySSF559613.18E-25772812No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009827Biological Processplant-type cell wall modification
GO:0042335Biological Processcuticle development
GO:0043481Biological Processanthocyanin accumulation in tissues in response to UV light
GO:0048765Biological Processroot hair cell differentiation
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 820 aa     Download sequence    Send to blast
MSFGGFFDNS SNGGGGGGGV GRVVTDLPYS NMPAGAISQS RLVAPSLTKS MFNSPGLSLA  60
LQTNMEGQGE MGGRIGESFD TALGVRTKED EYESRSGSDN MDGASGDDQD AEKPPRKKRY  120
HRHTPQQIQE LEALFKECPH PDEKQRMELS RRLCLESRQV KFWFQNRRTQ MKTQLERHEN  180
SILRQENDKL RAENMSIRDA MRNPICNNCG GPAMLGDVSL EEQHLRIENA RLKDELDRVC  240
ALAGKFLGRP VSSLGNSMPP PMPNSSLELG VGGNGFDGLS TVTTAMGPGN GYGVSVSNAM  300
TVMPSSRSGA GGMERSLEKS MFAELALAAM DELVKMAQTD EPLWMPGVGG KETLNQEEYM  360
RMFPPCIGMK PNGFVTEATR ETGMVIINAE ALVETLMDAN RWAEMFPCMI ARTSTADVIA  420
SGVGGTRNGS LQLMHAELQV LSPLVPIRES NFLRFCKQHA EGVWAVVDVS VDTNRETPNS  480
PAFVTCRRLP SGCVVQDMPN GYSKVIWVEH AEYDASIIHR LYRPLISAGM GFGAQRWVAT  540
LERQCECLAI LMSSVPTSDH SAITSSGRRS MLKLAQRMTN NFCAGVCAST IHKWNKLSVG  600
NVDEDVRVMT RKSIDDPGEP PGVVLSAATS VWLPVSPQKL FDFLRDEGLR SEWDILSNGG  660
PMQEMTHIAK GRDQGNCVSL LRASAMNSSQ SSMLILQETC IDAAGSLVVY APVDIPAMHV  720
VMSGGDSAYV ALLPSGFAIV PDGPGDGRSN QPSNSNSNNN NNGSSQSGGG GGGSLLTVAF  780
QILVNSLPTA KLTVESVETV NNLISCTVQK IKAALHCES*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00421DAPTransfer from AT4G00730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010661562.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X2
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLF6I3160.0F6I316_VITVI; Putative uncharacterized protein
STRINGVIT_15s0048g02000.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein